PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00031699-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 284aa    MW: 31609.7 Da    PI: 4.8391
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00031699-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.33.1e-12345145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                      rg ++++E  l+++++  lG++ W  Ia +++ gRt++++k+ w+
  PSME_00031699-RA  3 RGTFSPQEKSLIIELHGVLGNR-WYQIATHLP-GRTDNEIKNLWN 45
                      899*******************.*********.*********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.613152IPR017930Myb domain
SMARTSM007176.7E-9250IPR001005SANT/Myb domain
SuperFamilySSF466891.3E-11252IPR009057Homeodomain-like
PfamPF002495.0E-11345IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.7E-18448IPR009057Homeodomain-like
CDDcd001671.11E-7545No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
LKRGTFSPQE KSLIIELHGV LGNRWYQIAT HLPGRTDNEI KNLWNSPLNE VNAEAEDNKN  60
DNSNKKVETQ VAMDESHVSA GNEFKHLNAD TPNPKFFHVS IEDNSLFASD SQAMLHNGFM  120
NSNNSTTTTT STAIEPGFNF INQTSIAQGF TAEKDHKLID NPVLWVLQAL TRSVGFPTEN  180
LMPWPGQVSD KSVDVCDYNS IMVNPSMYRR GPCLSSLLYS ERSLDQDLLD NAGTNCMNGT  240
AQYWDNTENN NNNMRTSSRS SSCNSSTANL EVNNGTAFGH FWGF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ3990574e-73DQ399057.1 Pinus taeda R2R3-MYB transcription factor MYB8 mRNA, complete cds.
GenBankEU4828954e-73EU482895.1 Pinus pinaster R2R3-Myb8 transcription factor (Myb8) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA5JYF21e-152A5JYF2_PICGL; R2R3-MYB transcription factor MYB8
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-20myb domain protein 61